| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
| Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
| Protein automated matches [226904] (38 species) not a true protein |
| Species Campylobacter jejuni [TaxId:192222] [256007] (2 PDB entries) |
| Domain d3ouub2: 3ouu B:117-329 [248344] Other proteins in same PDB: d3ouua1, d3ouua3, d3ouua4, d3ouub1, d3ouub3 automated match to d1ulza3 complexed with anp, ca, cac, fmt, gol |
PDB Entry: 3ouu (more details), 2.25 Å
SCOPe Domain Sequences for d3ouub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouub2 d.142.1.0 (B:117-329) automated matches {Campylobacter jejuni [TaxId: 192222]}
kskakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenek
dlekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrh
qklieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqv
ehcvsemvsgidiieqmikvaegyalpsqesik
Timeline for d3ouub2:
View in 3DDomains from other chains: (mouse over for more information) d3ouua1, d3ouua2, d3ouua3, d3ouua4 |