Lineage for d3ouub2 (3ouu B:117-329)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979116Species Campylobacter jejuni [TaxId:192222] [256007] (2 PDB entries)
  8. 2979118Domain d3ouub2: 3ouu B:117-329 [248344]
    Other proteins in same PDB: d3ouua1, d3ouua3, d3ouua4, d3ouub1, d3ouub3
    automated match to d1ulza3
    complexed with anp, ca, cac, fmt, gol

Details for d3ouub2

PDB Entry: 3ouu (more details), 2.25 Å

PDB Description: Crystal Structure of Biotin Carboxylase-beta-gamma-ATP Complex from Campylobacter jejuni
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3ouub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouub2 d.142.1.0 (B:117-329) automated matches {Campylobacter jejuni [TaxId: 192222]}
kskakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenek
dlekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrh
qklieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqv
ehcvsemvsgidiieqmikvaegyalpsqesik

SCOPe Domain Coordinates for d3ouub2:

Click to download the PDB-style file with coordinates for d3ouub2.
(The format of our PDB-style files is described here.)

Timeline for d3ouub2: