Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (16 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [256008] (2 PDB entries) |
Domain d3ouua3: 3ouu A:330-443 [248342] Other proteins in same PDB: d3ouua1, d3ouua2, d3ouua4, d3ouub1, d3ouub2 automated match to d1ulza1 complexed with anp, ca, cac, fmt, gol |
PDB Entry: 3ouu (more details), 2.25 Å
SCOPe Domain Sequences for d3ouua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouua3 b.84.2.0 (A:330-443) automated matches {Campylobacter jejuni [TaxId: 192222]} lnghsiecritaedsktflpspgkitkyippagrnvrmeshcyqdysvpayydsmigklv vwaedrnkaiakmkvaldellisgikttkdfhlsmmenpdfinnnydtnylarh
Timeline for d3ouua3: