| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (40 species) not a true protein |
| Species Campylobacter jejuni [TaxId:192222] [256006] (2 PDB entries) |
| Domain d3ouub1: 3ouu B:1-116 [248343] Other proteins in same PDB: d3ouua2, d3ouua3, d3ouua4, d3ouub2, d3ouub3 automated match to d1ulza2 complexed with anp, ca, cac, fmt, gol |
PDB Entry: 3ouu (more details), 2.25 Å
SCOPe Domain Sequences for d3ouub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouub1 c.30.1.0 (B:1-116) automated matches {Campylobacter jejuni [TaxId: 192222]}
meiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkarsses
ylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsd
Timeline for d3ouub1:
View in 3DDomains from other chains: (mouse over for more information) d3ouua1, d3ouua2, d3ouua3, d3ouua4 |