Lineage for d3nvyb1 (3nvy B:195-414)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675806Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1675867Protein automated matches [232070] (1 species)
    not a true protein
  7. 1675868Species Cow (Bos taurus) [TaxId:9913] [232074] (10 PDB entries)
  8. 1675877Domain d3nvyb1: 3nvy B:195-414 [248055]
    Other proteins in same PDB: d3nvya1, d3nvya2, d3nvyb2, d3nvyc1, d3nvyc2, d3nvyj1, d3nvyj2, d3nvyk2, d3nvyl1, d3nvyl2
    automated match to d3nvvb1
    complexed with fad, fes, mos, mte, que

Details for d3nvyb1

PDB Entry: 3nvy (more details), 2 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Quercetin
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvyb1 d.145.1.3 (B:195-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpe
aklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvektlle
avaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtklti
vsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOPe Domain Coordinates for d3nvyb1:

Click to download the PDB-style file with coordinates for d3nvyb1.
(The format of our PDB-style files is described here.)

Timeline for d3nvyb1: