Lineage for d3nvvb1 (3nvv B:195-414)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
consists of two alpha+beta subdomainsSuperfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) 
Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
automatically mapped to Pfam PF00941
Protein automated matches [232070] (1 species)
not a true proteinSpecies Cow (Bos taurus) [TaxId:9913] [232074] (10 PDB entries) 
Domain d3nvvb1: 3nvv B:195-414 [233053]
Other proteins in same PDB: d3nvva1, d3nvva2, d3nvvb2, d3nvvc1, d3nvvc2, d3nvvj1, d3nvvj2, d3nvvk2, d3nvvl1, d3nvvl2
automated match to d1v97a6
complexed with ast, fad, fes, mos, mte
Details for d3nvvb1
PDB Entry: 3nvv (more details), 1.82 Å
PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Arsenite
PDB Compounds: (B:) Xanthine dehydrogenase/oxidaseSCOPe Domain Sequences for d3nvvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvvb1 d.145.1.3 (B:195-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
lfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpe
aklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvektlle
avaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtklti
vsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre
SCOPe Domain Coordinates for d3nvvb1:
Click to download the PDB-style file with coordinates for d3nvvb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3nvvb1:
- d3nvvb1 first appeared in SCOPe 2.03
- d3nvvb1 appears in SCOPe 2.05
- d3nvvb1 appears in the current release, SCOPe 2.08
View in 3D
