Lineage for d3nvyj2 (3nvy J:93-165)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493241Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1493242Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1493243Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 1493321Protein automated matches [232101] (1 species)
    not a true protein
  7. 1493322Species Cow (Bos taurus) [TaxId:9913] [232106] (9 PDB entries)
  8. 1493332Domain d3nvyj2: 3nvy J:93-165 [248060]
    Other proteins in same PDB: d3nvya1, d3nvyb1, d3nvyb2, d3nvyc1, d3nvyc2, d3nvyj1, d3nvyk1, d3nvyk2, d3nvyl1, d3nvyl2
    automated match to d3etrl2
    complexed with fad, fes, mos, mte, que

Details for d3nvyj2

PDB Entry: 3nvy (more details), 2 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Quercetin
PDB Compounds: (J:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvyj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvyj2 a.56.1.1 (J:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3nvyj2:

Click to download the PDB-style file with coordinates for d3nvyj2.
(The format of our PDB-style files is described here.)

Timeline for d3nvyj2: