| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) ![]() automatically mapped to Pfam PF03450 |
| Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
| Protein automated matches [232090] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries) |
| Domain d3nvyb2: 3nvy B:415-528 [248056] Other proteins in same PDB: d3nvya1, d3nvya2, d3nvyb1, d3nvyc1, d3nvyc2, d3nvyj1, d3nvyj2, d3nvyk1, d3nvyl1, d3nvyl2 automated match to d3nvvb2 complexed with fad, fes, mos, mte, que |
PDB Entry: 3nvy (more details), 2 Å
SCOPe Domain Sequences for d3nvyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvyb2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3nvyb2: