Lineage for d1kwab_ (1kwa B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13490Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 13491Superfamily b.36.1: PDZ domain-like [50156] (2 families) (S)
  5. 13492Family b.36.1.1: PDZ domain [50157] (7 proteins)
  6. 13493Protein Cask/Lin-2 [50160] (1 species)
  7. 13494Species Human (Homo sapiens) [TaxId:9606] [50161] (1 PDB entry)
  8. 13496Domain d1kwab_: 1kwa B: [24773]

Details for d1kwab_

PDB Entry: 1kwa (more details), 1.93 Å

PDB Description: human cask/lin-2 pdz domain

SCOP Domain Sequences for d1kwab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kwab_ b.36.1.1 (B:) Cask/Lin-2 {Human (Homo sapiens)}
rsrlvqfqkntdepmgitlkmlnhcivarimhggmihrqgtlhvgdeireingisvanqt
veqlqkmlremrgsitfkivpsyref

SCOP Domain Coordinates for d1kwab_:

Click to download the PDB-style file with coordinates for d1kwab_.
(The format of our PDB-style files is described here.)

Timeline for d1kwab_:

13496
d1kwab_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1kwaa_