Lineage for d1kwab_ (1kwa B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2785902Protein Cask/Lin-2 [50160] (1 species)
  7. 2785903Species Human (Homo sapiens) [TaxId:9606] [50161] (1 PDB entry)
  8. 2785905Domain d1kwab_: 1kwa B: [24773]
    complexed with so4

Details for d1kwab_

PDB Entry: 1kwa (more details), 1.93 Å

PDB Description: human cask/lin-2 pdz domain
PDB Compounds: (B:) hcask/lin-2 protein

SCOPe Domain Sequences for d1kwab_:

Sequence, based on SEQRES records: (download)

>d1kwab_ b.36.1.1 (B:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]}
rsrlvqfqkntdepmgitlkmnelnhcivarimhggmihrqgtlhvgdeireingisvan
qtveqlqkmlremrgsitfkivpsyref

Sequence, based on observed residues (ATOM records): (download)

>d1kwab_ b.36.1.1 (B:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]}
rsrlvqfqkntdepmgitlkmlnhcivarimhggmihrqgtlhvgdeireingisvanqt
veqlqkmlremrgsitfkivpsyref

SCOPe Domain Coordinates for d1kwab_:

Click to download the PDB-style file with coordinates for d1kwab_.
(The format of our PDB-style files is described here.)

Timeline for d1kwab_: