Lineage for d3l73p1 (3l73 P:2-261)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577736Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2577737Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 2577743Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2577799Protein automated matches [196844] (6 species)
    not a true protein
  7. 2577802Species Chicken (Gallus gallus) [TaxId:9031] [255856] (4 PDB entries)
  8. 2577806Domain d3l73p1: 3l73 P:2-261 [247404]
    Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_
    automated match to d3l75p1
    complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73p1

PDB Entry: 3l73 (more details), 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor
PDB Compounds: (P:) cytochrome b

SCOPe Domain Sequences for d3l73p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l73p1 f.21.1.2 (P:2-261) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
tlalfspnllgdpenftpan

SCOPe Domain Coordinates for d3l73p1:

Click to download the PDB-style file with coordinates for d3l73p1.
(The format of our PDB-style files is described here.)

Timeline for d3l73p1: