| Class b: All beta proteins [48724] (180 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
| Protein automated matches [190874] (7 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [260680] (8 PDB entries) |
| Domain d3l73e2: 3l73 E:70-196 [262302] Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73s_, d3l73t_, d3l73u_, d3l73w_ automated match to d3l70e2 complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq |
PDB Entry: 3l73 (more details), 3.04 Å
SCOPe Domain Sequences for d3l73e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l73e2 b.33.1.1 (E:70-196) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alskieiklsdipegknvafkwrgkplfvrhrtqaeinqeaevdvsklrdpqhdldrvkk
pewvilvgvcthlgcvpiansgdfggyycpchgshydasgrirkgpapynlevptyqfvg
ddlvvvg
Timeline for d3l73e2:
View in 3DDomains from other chains: (mouse over for more information) d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_ |