| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
| Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
| Protein automated matches [190042] (4 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries) |
| Domain d3l73u_: 3l73 U: [247410] Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73w_ automated match to d3l75h_ complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq |
PDB Entry: 3l73 (more details), 3.04 Å
SCOPe Domain Sequences for d3l73u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l73u_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah
klfnklk
Timeline for d3l73u_:
View in 3DDomains from other chains: (mouse over for more information) d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73w_ |