Lineage for d3l5qc_ (3l5q C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228659Domain d3l5qc_: 3l5q C: [247341]
    Other proteins in same PDB: d3l5q1_, d3l5q2_, d3l5q3_, d3l5q4_, d3l5qb2, d3l5qd2, d3l5qk_, d3l5ql_, d3l5qm_, d3l5qn_, d3l5qo_, d3l5qp_, d3l5qq_, d3l5qr_, d3l5qw_, d3l5qx_, d3l5qy_, d3l5qz_

Details for d3l5qc_

PDB Entry: 3l5q (more details), 3 Å

PDB Description: Proteasome Activator Complex
PDB Compounds: (C:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3l5qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l5qc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3l5qc_:

Click to download the PDB-style file with coordinates for d3l5qc_.
(The format of our PDB-style files is described here.)

Timeline for d3l5qc_: