SCOPe 2.06: Domain d3l5qb1: 3l5q B:1002-1196

Lineage for d3l5qb1 (3l5q B:1002-1196)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d3l5qb1: 3l5q B:1002-1196 [247340]
   Other proteins in same PDB: d3l5q1_, d3l5q2_, d3l5q3_, d3l5q4_, d3l5qb2, d3l5qd2, d3l5qk_, d3l5ql_, d3l5qm_, d3l5qn_, d3l5qo_, d3l5qp_, d3l5qq_, d3l5qr_, d3l5qw_, d3l5qx_, d3l5qy_, d3l5qz_

Details for d3l5qb1

PDB Entry: 3l5q, 3 Å

PDB Description: Proteasome Activator Complex

PDB Compounds: (B:) Proteasome component PRE3

SCOPe Domain Sequences for d3l5qb1:

Sequence; same for both SEQRES and ATOM records:

>d3l5qb1 d.153.1.4 (B:1002-1196) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
simavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivqy
hlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvhk
lpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvltaa
gverlifypdeyeql

Timeline for d3l5qb1:

• d3l5qb1 first appeared in SCOPe 2.04, called d3l5qb_
  
• d3l5qb1 was called d3l5qb_ in SCOPe 2.05
  
• d3l5qb1 appears in SCOPe 2.07
  
• d3l5qb1 appears in the current release, SCOPe 2.08