Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d3l5qu_: 3l5q U: [247354] Other proteins in same PDB: d3l5q1_, d3l5q2_, d3l5q3_, d3l5q4_, d3l5qb2, d3l5qd2, d3l5qk_, d3l5ql_, d3l5qm_, d3l5qn_, d3l5qo_, d3l5qp_, d3l5qq_, d3l5qr_, d3l5qw_, d3l5qx_, d3l5qy_, d3l5qz_ |
PDB Entry: 3l5q (more details), 3 Å
SCOPe Domain Sequences for d3l5qu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l5qu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritpskvskidshvvlsfs glnadsriliekarveaqshrltledpvtveyltryvagvqqrytqsggvrpfgvstlia gfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrkeppatveecvkltv rsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqeq
Timeline for d3l5qu_: