SCOPe 2.08: Domain d3hera_: 3her A:

Lineage for d3hera_ (3her A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188783] (10 PDB entries)

8. Domain d3hera_: 3her A: [246491]
   automated match to d1fo7a_
   complexed with cd

Details for d3hera_

PDB Entry: 3her, 1.85 Å

PDB Description: human prion protein variant f198s with v129

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d3hera_:

Sequence, based on SEQRES records:

>d3hera_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenstetdvkmmervveqmcitqyeresqayy

Sequence, based on observed residues (ATOM records):

>d3hera_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvtttstetdvkmmervveqmcitqyeresqayy

Timeline for d3hera_:

• d3hera_ first appeared in SCOPe 2.04
  
• d3hera_ appears in SCOPe 2.07