Lineage for d3hera_ (3her A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635622Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1635623Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1635624Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1635688Protein automated matches [191016] (6 species)
    not a true protein
  7. 1635693Species Human (Homo sapiens) [TaxId:9606] [188783] (8 PDB entries)
  8. 1635695Domain d3hera_: 3her A: [246491]
    automated match to d1fo7a_
    complexed with cd

Details for d3hera_

PDB Entry: 3her (more details), 1.85 Å

PDB Description: human prion protein variant f198s with v129
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d3hera_:

Sequence, based on SEQRES records: (download)

>d3hera_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvttttkgenstetdvkmmervveqmcitqyeresqayy

Sequence, based on observed residues (ATOM records): (download)

>d3hera_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhdcvniti
kqhtvtttstetdvkmmervveqmcitqyeresqayy

SCOPe Domain Coordinates for d3hera_:

Click to download the PDB-style file with coordinates for d3hera_.
(The format of our PDB-style files is described here.)

Timeline for d3hera_: