SCOPe 2.08: Domain d3g8db2: 3g8d B:115-330

Lineage for d3g8db2 (3g8d B:115-330)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)

6. Protein automated matches [254674] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255842] (2 PDB entries)

8. Domain d3g8db2: 3g8d B:115-330 [246269]
   Other proteins in same PDB: d3g8da1, d3g8da2, d3g8db1, d3g8db3
   automated match to d2w70a2
   complexed with adp, mg, so4; mutant

Details for d3g8db2

PDB Entry: 3g8d, 1.9 Å

PDB Description: crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3g8db2:

Sequence; same for both SEQRES and ATOM records:

>d3g8db2 d.142.1.2 (B:115-330) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vahpvtemitgvdlikeqlriaagqplsikqeevhv

Timeline for d3g8db2:

• d3g8db2 first appeared in SCOPe 2.04
  
• d3g8db2 appears in SCOPe 2.07