Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins) |
Protein automated matches [254674] (3 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255842] (2 PDB entries) |
Domain d3g8db2: 3g8d B:115-330 [246269] Other proteins in same PDB: d3g8da1, d3g8da2, d3g8db1, d3g8db3 automated match to d2w70a2 complexed with adp, mg, so4; mutant |
PDB Entry: 3g8d (more details), 1.9 Å
SCOPe Domain Sequences for d3g8db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g8db2 d.142.1.2 (B:115-330) automated matches {Escherichia coli K-12 [TaxId: 83333]} dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq vahpvtemitgvdlikeqlriaagqplsikqeevhv
Timeline for d3g8db2: