Lineage for d3g8db3 (3g8d B:331-444)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817679Species Escherichia coli K-12 [TaxId:83333] [255843] (2 PDB entries)
  8. 2817681Domain d3g8db3: 3g8d B:331-444 [246270]
    Other proteins in same PDB: d3g8da1, d3g8db1, d3g8db2
    automated match to d2w70a3
    complexed with adp, mg, so4; mutant

Details for d3g8db3

PDB Entry: 3g8d (more details), 1.9 Å

PDB Description: crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3g8db3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8db3 b.84.2.0 (B:331-444) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekkl

SCOPe Domain Coordinates for d3g8db3:

Click to download the PDB-style file with coordinates for d3g8db3.
(The format of our PDB-style files is described here.)

Timeline for d3g8db3: