PDB entry 3g8d

View 3g8d on RCSB PDB site
Description: Crystal structure of the biotin carboxylase subunit, E296A mutant, of acetyl-COA carboxylase from Escherichia coli
Class: ligase
Keywords: ATP-GRASP, CARBOXYLASE, BIOTIN-DEPENDENT, FATTY ACID SYNTHESIS, ACTIVE SITE MUTANT, ATP-binding, Biotin, Fatty acid biosynthesis, Ligase, Lipid synthesis, Nucleotide-binding
Deposited on 2009-02-12, released 2009-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:83333]
    Gene: accC, b3256, fabG, JW3224
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24182 (0-443)
      • engineered (295)
    Domains in SCOPe 2.08: d3g8da1, d3g8da2
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:83333]
    Gene: accC, b3256, fabG, JW3224
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24182 (0-443)
      • engineered (295)
    Domains in SCOPe 2.08: d3g8db1, d3g8db2, d3g8db3
  • Heterogens: SO4, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g8dA (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvahpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g8dA (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvplenprhveiqvladgqgnaiylaerdcsmqrrhqkvveeapapgitpe
    lrryigercakacvdigyrgagtfeflfengefyfiemntriqvahpvtemitgvdlike
    qlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhapggfgvrweshi
    yagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdlqirimndenfq
    hggtnihylekkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g8dB (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvahpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekkl