![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
![]() | Protein automated matches [226903] (40 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255841] (2 PDB entries) |
![]() | Domain d3g8da1: 3g8d A:1-114 [246266] Other proteins in same PDB: d3g8da2, d3g8db2, d3g8db3 automated match to d2w70a1 complexed with adp, mg, so4; mutant |
PDB Entry: 3g8d (more details), 1.9 Å
SCOPe Domain Sequences for d3g8da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g8da1 c.30.1.0 (A:1-114) automated matches {Escherichia coli K-12 [TaxId: 83333]} mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d3g8da1: