SCOPe 2.07: Domain d3g8da1: 3g8d A:1-114

Lineage for d3g8da1 (3g8d A:1-114)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (39 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255841] (2 PDB entries)

8. Domain d3g8da1: 3g8d A:1-114 [246266]
   Other proteins in same PDB: d3g8da2, d3g8db2, d3g8db3
   automated match to d2w70a1
   complexed with adp, mg, so4; mutant

Details for d3g8da1

PDB Entry: 3g8d, 1.9 Å

PDB Description: crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3g8da1:

Sequence; same for both SEQRES and ATOM records:

>d3g8da1 c.30.1.0 (A:1-114) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

Timeline for d3g8da1:

• d3g8da1 first appeared in SCOPe 2.04
  
• d3g8da1 appears in SCOPe 2.06
  
• d3g8da1 appears in the current release, SCOPe 2.08