Lineage for d3g8db2 (3g8d B:115-330)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585083Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2585259Protein automated matches [254674] (3 species)
    not a true protein
  7. 2585260Species Escherichia coli K-12 [TaxId:83333] [255842] (2 PDB entries)
  8. 2585261Domain d3g8db2: 3g8d B:115-330 [246269]
    Other proteins in same PDB: d3g8da1, d3g8da2, d3g8db1, d3g8db3
    automated match to d2w70a2
    complexed with adp, mg, so4; mutant

Details for d3g8db2

PDB Entry: 3g8d (more details), 1.9 Å

PDB Description: crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3g8db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8db2 d.142.1.2 (B:115-330) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vahpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d3g8db2:

Click to download the PDB-style file with coordinates for d3g8db2.
(The format of our PDB-style files is described here.)

Timeline for d3g8db2: