SCOPe 2.08: Domain d3azed_: 3aze D:

Lineage for d3azed_ (3aze D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)

8. Domain d3azed_: 3aze D: [245293]
   automated match to d4cayb_
   protein/DNA complex; complexed with cl, mn; mutant

Details for d3azed_

PDB Entry: 3aze, 3 Å

PDB Description: Crystal Structure of Human Nucleosome Core Particle Containing H3K64Q mutation

PDB Compounds: (D:) Histone H2B type 1-J

SCOPe Domain Sequences for d3azed_:

Sequence; same for both SEQRES and ATOM records:

>d3azed_ a.22.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsa

Timeline for d3azed_:

• d3azed_ first appeared in SCOPe 2.04
  
• d3azed_ appears in SCOPe 2.07