PDB entry 3aze

View 3aze on RCSB PDB site
Description: Crystal Structure of Human Nucleosome Core Particle Containing H3K64Q mutation
Class: structural protein/DNA
Keywords: HISTONE-FOLD, NUCLEOSOME, STRUCTURAL PROTEIN-DNA complex
Deposited on 2011-05-25, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.244
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68431
      • engineered mutation (67)
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azeb_
  • Chain 'C':
    Compound: Histone H2A type 1-B/E
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azec_
  • Chain 'D':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azed_
  • Chain 'E':
    Compound: Histone H3.1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68431 (Start-138)
      • engineered mutation (67)
  • Chain 'F':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azef_
  • Chain 'G':
    Compound: Histone H2A type 1-B/E
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azeg_
  • Chain 'H':
    Compound: Histone H2B type 1-J
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3azeh_
  • Chain 'I':
    Compound: 146-mer DNA
  • Chain 'J':
    Compound: 146-mer DNA
  • Heterogens: CL, MN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3azeB (B:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azeB (B:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3azeC (C:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azeC (C:)
    rakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaa
    rdnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3azeD (D:)
    gshmpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtk
    avtkytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azeD (D:)
    rsrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstit
    sreiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3azeF (F:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azeF (F:)
    hrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehak
    rktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3azeG (G:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azeG (G:)
    ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3azeH (H:)
    gshmpepaksapapkkgskkavtkaqkkdgkkrkrsrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtk
    avtkytsak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3azeH (H:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.