![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
![]() | Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
![]() | Protein Protein H of glycine cleavage system [51236] (4 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189182] (6 PDB entries) |
![]() | Domain d3a7ad_: 3a7a D: [245068] Other proteins in same PDB: d3a7aa1, d3a7aa2, d3a7ac1, d3a7ac2 automated match to d3a7la_ complexed with amp, oct |
PDB Entry: 3a7a (more details), 3.1 Å
SCOPe Domain Sequences for d3a7ad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a7ad_ b.84.1.1 (D:) Protein H of glycine cleavage system {Escherichia coli K-12 [TaxId: 83333]} nvpaelkyskehewlrkeadgtytvgitehaqellgdmvfvdlpevgatvsagddcavae svkaasdiyapvsgeivavndalsdspelvnsepyaggwifkikasdeseleslldatay eallede
Timeline for d3a7ad_: