| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
| Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins) automatically mapped to Pfam PF10437 |
| Protein Two-domain LplA, C-terminal domain [160211] (1 species) |
| Species Escherichia coli [TaxId:562] [160212] (5 PDB entries) Uniprot P32099 247-337 |
| Domain d3a7aa2: 3a7a A:247-337 [245064] Other proteins in same PDB: d3a7aa1, d3a7ab_, d3a7ac1, d3a7ad_ automated match to d3a7ra2 complexed with amp, oct |
PDB Entry: 3a7a (more details), 3.1 Å
SCOPe Domain Sequences for d3a7aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a7aa2 d.224.1.3 (A:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr
Timeline for d3a7aa2:
View in 3DDomains from other chains: (mouse over for more information) d3a7ab_, d3a7ac1, d3a7ac2, d3a7ad_ |