SCOPe 2.08: Domain d3a7aa2: 3a7a A:247-337

Lineage for d3a7aa2 (3a7a A:247-337)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
   automatically mapped to Pfam PF10437

6. Protein Two-domain LplA, C-terminal domain [160211] (1 species)

7. Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
   Uniprot P32099 247-337

8. Domain d3a7aa2: 3a7a A:247-337 [245064]
   Other proteins in same PDB: d3a7aa1, d3a7ab_, d3a7ac1, d3a7ad_
   automated match to d3a7ra2
   complexed with amp, oct

Details for d3a7aa2

PDB Entry: 3a7a, 3.1 Å

PDB Description: crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein

PDB Compounds: (A:) Lipoate-protein ligase A

SCOPe Domain Sequences for d3a7aa2:

Sequence; same for both SEQRES and ATOM records:

>d3a7aa2 d.224.1.3 (A:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr

Timeline for d3a7aa2:

• d3a7aa2 first appeared in SCOPe 2.04
  
• d3a7aa2 appears in SCOPe 2.07