Lineage for d3a7aa2 (3a7a A:247-337)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007755Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
    automatically mapped to Pfam PF10437
  6. 3007759Protein Two-domain LplA, C-terminal domain [160211] (1 species)
  7. 3007760Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
    Uniprot P32099 247-337
  8. 3007770Domain d3a7aa2: 3a7a A:247-337 [245064]
    Other proteins in same PDB: d3a7aa1, d3a7ab_, d3a7ac1, d3a7ad_
    automated match to d3a7ra2
    complexed with amp, oct

Details for d3a7aa2

PDB Entry: 3a7a (more details), 3.1 Å

PDB Description: crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein
PDB Compounds: (A:) Lipoate-protein ligase A

SCOPe Domain Sequences for d3a7aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a7aa2 d.224.1.3 (A:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr

SCOPe Domain Coordinates for d3a7aa2:

Click to download the PDB-style file with coordinates for d3a7aa2.
(The format of our PDB-style files is described here.)

Timeline for d3a7aa2: