SCOPe 2.06: Domain d3a7ac1: 3a7a C:1-246

Lineage for d3a7ac1 (3a7a C:1-246)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.3: LplA-like [143642] (6 proteins)
   part of Pfam PF03099

6. Protein Two-domain LplA, N-terminal domain [160607] (1 species)

7. Species Escherichia coli [TaxId:562] [160608] (5 PDB entries)
   Uniprot P32099 1-246

8. Domain d3a7ac1: 3a7a C:1-246 [245066]
   Other proteins in same PDB: d3a7aa2, d3a7ab_, d3a7ac2, d3a7ad_
   automated match to d3a7ra1
   complexed with amp, oct

Details for d3a7ac1

PDB Entry: 3a7a, 3.1 Å

PDB Description: crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein

PDB Compounds: (C:) Lipoate-protein ligase A

SCOPe Domain Sequences for d3a7ac1:

Sequence; same for both SEQRES and ATOM records:

>d3a7ac1 d.104.1.3 (C:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg

Timeline for d3a7ac1:

• d3a7ac1 first appeared in SCOPe 2.04
  
• d3a7ac1 appears in SCOPe 2.05
  
• d3a7ac1 appears in SCOPe 2.07
  
• d3a7ac1 appears in the current release, SCOPe 2.08