SCOPe 2.06: Domain d2yw2b1: 2yw2 B:1-101

Lineage for d2yw2b1 (2yw2 B:1-101)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (35 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [255712] (2 PDB entries)

8. Domain d2yw2b1: 2yw2 B:1-101 [244839]
   Other proteins in same PDB: d2yw2a2, d2yw2a3, d2yw2b2, d2yw2b3
   automated match to d1gsoa2
   complexed with atp, po4

Details for d2yw2b1

PDB Entry: 2yw2, 1.8 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus in complex with ATP

PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yw2b1:

Sequence; same for both SEQRES and ATOM records:

>d2yw2b1 c.30.1.0 (B:1-101) automated matches {Aquifex aeolicus [TaxId: 63363]}
mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
egvdftivgpeaplvegivdefekrglkifgpnkeaakleg

Timeline for d2yw2b1:

• d2yw2b1 first appeared in SCOPe 2.04
  
• d2yw2b1 appears in SCOPe 2.05
  
• d2yw2b1 appears in SCOPe 2.07
  
• d2yw2b1 appears in the current release, SCOPe 2.08