Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (32 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [255713] (2 PDB entries) |
Domain d2yw2a2: 2yw2 A:102-322 [244837] Other proteins in same PDB: d2yw2a1, d2yw2a3, d2yw2b1, d2yw2b3 automated match to d1gsoa3 complexed with atp, po4 |
PDB Entry: 2yw2 (more details), 1.8 Å
SCOPe Domain Sequences for d2yw2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yw2a2 d.142.1.0 (A:102-322) automated matches {Aquifex aeolicus [TaxId: 63363]} skafaktfmkkygiptaryevftdfekakeyvekvgapivvkadglaagkgavvcetvek aietldrflnkkifgksservvieeflegeeasyivmingdryvplptsqdhkrlldedk gpntggmgaysptpvineevekrireeivervikglkeegiyyrgflyaglmitkegpkv lefnvrlgdpeaqpilmrvkndfletllnfyegkdvhiked
Timeline for d2yw2a2: