Lineage for d2yw2a2 (2yw2 A:102-322)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217686Species Aquifex aeolicus [TaxId:63363] [255713] (2 PDB entries)
  8. 2217687Domain d2yw2a2: 2yw2 A:102-322 [244837]
    Other proteins in same PDB: d2yw2a1, d2yw2a3, d2yw2b1, d2yw2b3
    automated match to d1gsoa3
    complexed with atp, po4

Details for d2yw2a2

PDB Entry: 2yw2 (more details), 1.8 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus in complex with ATP
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yw2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yw2a2 d.142.1.0 (A:102-322) automated matches {Aquifex aeolicus [TaxId: 63363]}
skafaktfmkkygiptaryevftdfekakeyvekvgapivvkadglaagkgavvcetvek
aietldrflnkkifgksservvieeflegeeasyivmingdryvplptsqdhkrlldedk
gpntggmgaysptpvineevekrireeivervikglkeegiyyrgflyaglmitkegpkv
lefnvrlgdpeaqpilmrvkndfletllnfyegkdvhiked

SCOPe Domain Coordinates for d2yw2a2:

Click to download the PDB-style file with coordinates for d2yw2a2.
(The format of our PDB-style files is described here.)

Timeline for d2yw2a2: