Lineage for d1gsoa2 (1gso A:-2-103)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120506Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2120650Protein Glycinamide ribonucleotide synthetase (GAR-syn), N-domain [52444] (2 species)
  7. 2120651Species Escherichia coli [TaxId:562] [52445] (1 PDB entry)
  8. 2120652Domain d1gsoa2: 1gso A:-2-103 [31647]
    Other proteins in same PDB: d1gsoa1, d1gsoa3

Details for d1gsoa2

PDB Entry: 1gso (more details), 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.
PDB Compounds: (A:) protein (glycinamide ribonucleotide synthetase)

SCOPe Domain Sequences for d1gsoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsoa2 c.30.1.1 (A:-2-103) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Escherichia coli [TaxId: 562]}
efmkvlvignggrehalawkaaqsplvetvfvapgnagtalepalqnvaigvtdipalld
faqnekidltivgpeaplvkgvvdtfraaglkifgptagaaqleg

SCOPe Domain Coordinates for d1gsoa2:

Click to download the PDB-style file with coordinates for d1gsoa2.
(The format of our PDB-style files is described here.)

Timeline for d1gsoa2: