![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (7 superfamilies) |
![]() | Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families) ![]() |
![]() | Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein) |
![]() | Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [50040] (2 PDB entries) |
![]() | Domain d1bia_2: 1bia 271-317 [24447] Other proteins in same PDB: d1bia_1, d1bia_3 |
PDB Entry: 1bia (more details), 2.3 Å
SCOP Domain Sequences for d1bia_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bia_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli} finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr
Timeline for d1bia_2: