SCOP 1.57: Domain d1bia_2: 1bia 271-317

Lineage for d1bia_2 (1bia 271-317)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families)

5. Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein)

6. Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)

7. Species Escherichia coli [TaxId:562] [50040] (3 PDB entries)

8. Domain d1bia_2: 1bia 271-317 [24447]
   Other proteins in same PDB: d1bia_1, d1bia_3

Details for d1bia_2

PDB Entry: 1bia, 2.3 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bia_2:

Sequence; same for both SEQRES and ATOM records:

>d1bia_2 b.34.1.1 (271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

Timeline for d1bia_2:

• d1bia_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bia_2 appears in SCOP 1.59
  
• d1bia_2 appears in the current release, SCOPe 2.08, called d1biaa2