Lineage for d2ws93_ (2ws9 3:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822534Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2822535Protein automated matches [190988] (51 species)
    not a true protein
  7. 2822626Species Equine rhinitis a virus [TaxId:47000] [255665] (1 PDB entry)
  8. 2822627Domain d2ws93_: 2ws9 3: [244274]
    automated match to d1cov3_

Details for d2ws93_

PDB Entry: 2ws9 (more details), 3 Å

PDB Description: equine rhinitis a virus at low ph
PDB Compounds: (3:) p1

SCOPe Domain Sequences for d2ws93_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ws93_ b.121.4.0 (3:) automated matches {Equine rhinitis a virus [TaxId: 47000]}
apirvvsvpesdsfmssvpdnstplypkvvvpprqvpgrftnfidvakqtysfcsisgkp
yfevtntsgdeplfqmdvslsaaelhgtyvaslssffaqyrgslnfnfiftgaaatkakf
lvafvpphsaapktrdeamacihavwdvglnsafsfnvpysspadfmavysaeatvvnvs
gwlqvyaltaltstdiavnskgrvlvavsagpdfslrhpvdlpdkq

SCOPe Domain Coordinates for d2ws93_:

Click to download the PDB-style file with coordinates for d2ws93_.
(The format of our PDB-style files is described here.)

Timeline for d2ws93_: