Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (22 species) not a true protein |
Species Equine rhinitis a virus [TaxId:47000] [255665] (1 PDB entry) |
Domain d2ws93_: 2ws9 3: [244274] automated match to d1cov3_ |
PDB Entry: 2ws9 (more details), 3 Å
SCOPe Domain Sequences for d2ws93_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ws93_ b.121.4.0 (3:) automated matches {Equine rhinitis a virus [TaxId: 47000]} apirvvsvpesdsfmssvpdnstplypkvvvpprqvpgrftnfidvakqtysfcsisgkp yfevtntsgdeplfqmdvslsaaelhgtyvaslssffaqyrgslnfnfiftgaaatkakf lvafvpphsaapktrdeamacihavwdvglnsafsfnvpysspadfmavysaeatvvnvs gwlqvyaltaltstdiavnskgrvlvavsagpdfslrhpvdlpdkq
Timeline for d2ws93_: