Lineage for d2wq6a1 (2wq6 A:2-215)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470051Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2470052Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2470089Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 2470090Protein automated matches [227113] (4 species)
    not a true protein
  7. 2470098Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (6 PDB entries)
  8. 2470100Domain d2wq6a1: 2wq6 A:2-215 [244203]
    Other proteins in same PDB: d2wq6a2
    automated match to d2wb2a1
    protein/DNA complex; complexed with fad

Details for d2wq6a1

PDB Entry: 2wq6 (more details), 2.3 Å

PDB Description: structure of the 6-4 photolyase of d. melanogaster in complex with the non-natural n4-methyl t(dewar)c lesion
PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d2wq6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wq6a1 c.28.1.0 (A:2-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dsqrstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrw
rflqqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaa
vqklakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpekl
knmptppkdeveqkdsaaydcptmkqlvkrpeel

SCOPe Domain Coordinates for d2wq6a1:

Click to download the PDB-style file with coordinates for d2wq6a1.
(The format of our PDB-style files is described here.)

Timeline for d2wq6a1: