| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) ![]() automatically mapped to Pfam PF00875 |
| Family c.28.1.0: automated matches [227292] (1 protein) not a true family |
| Protein automated matches [227113] (4 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (6 PDB entries) |
| Domain d2wq6a1: 2wq6 A:2-215 [244203] Other proteins in same PDB: d2wq6a2 automated match to d2wb2a1 protein/DNA complex; complexed with fad |
PDB Entry: 2wq6 (more details), 2.3 Å
SCOPe Domain Sequences for d2wq6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wq6a1 c.28.1.0 (A:2-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dsqrstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrw
rflqqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaa
vqklakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpekl
knmptppkdeveqkdsaaydcptmkqlvkrpeel
Timeline for d2wq6a1: