![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily) multihelical; consists of two all-alpha subdomains |
![]() | Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) ![]() automatically mapped to Pfam PF03441 |
![]() | Family a.99.1.0: automated matches [231382] (1 protein) not a true family |
![]() | Protein automated matches [231383] (3 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231384] (6 PDB entries) |
![]() | Domain d2wq6a2: 2wq6 A:216-509 [244204] Other proteins in same PDB: d2wq6a1 automated match to d2wb2a2 protein/DNA complex; complexed with fad |
PDB Entry: 2wq6 (more details), 2.3 Å
SCOPe Domain Sequences for d2wq6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wq6a2 a.99.1.0 (A:216-509) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} gpnkfpggetealrrmeeslkdeiwvarfekpntapnslepsttvlspylkfgclsarlf nqklkeiikrqpkhsqppvsligqlmwrefyytvaaaepnfdrmlgnvycmqipwqehpd hleawthgrtgypfidaimrqlrqegwihhlarhavacfltrgdlwisweegqrvfeqll ldqdwalnagnwmwlsasaffhqyfrvyspvafgkktdpqghyirkyvpelskypagciy epwkaslvdqraygcvlgtdyphrivkhevvhkenikrmgaaykvnrevrtgke
Timeline for d2wq6a2: