Lineage for d2wb2a2 (2wb2 A:216-509)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
multihelical; consists of two all-alpha subdomainsSuperfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) 
automatically mapped to Pfam PF03441
Family a.99.1.0: automated matches [231382] (1 protein)
not a true familyProtein automated matches [231383] (3 species)
not a true proteinSpecies Fruit fly (Drosophila melanogaster) [TaxId:7227] [231384] (6 PDB entries) 
Domain d2wb2a2: 2wb2 A:216-509 [231385]
Other proteins in same PDB: d2wb2a1
automated match to d4mlpa2
protein/DNA complex; complexed with fad
Details for d2wb2a2
PDB Entry: 2wb2 (more details), 2.95 Å
PDB Description: drosophila melanogaster (6-4) photolyase bound to double stranded dna containing a t(6-4)c photolesion
PDB Compounds: (A:) photolyaseSCOPe Domain Sequences for d2wb2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wb2a2 a.99.1.0 (A:216-509) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gpnkfpggetealrrmeeslkdeiwvarfekpntapnslepsttvlspylkfgclsarlf
nqklkeiikrqpkhsqppvsligqlmwrefyytvaaaepnfdrmlgnvycmqipwqehpd
hleawthgrtgypfidaimrqlrqegwihhlarhavacfltrgdlwisweegqrvfeqll
ldqdwalnagnwmwlsasaffhqyfrvyspvafgkktdpqghyirkyvpelskypagciy
epwkaslvdqraygcvlgtdyphrivkhevvhkenikrmgaaykvnrevrtgke
SCOPe Domain Coordinates for d2wb2a2:
Click to download the PDB-style file with coordinates for d2wb2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wb2a2:
- d2wb2a2 first appeared in SCOPe 2.03
- d2wb2a2 appears in SCOPe 2.06
- d2wb2a2 appears in the current release, SCOPe 2.08
View in 3D
