SCOPe 2.08: Domain d2wq6a1: 2wq6 A:2-215

Lineage for d2wq6a1 (2wq6 A:2-215)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (4 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (8 PDB entries)

8. Domain d2wq6a1: 2wq6 A:2-215 [244203]
   Other proteins in same PDB: d2wq6a2
   automated match to d2wb2a1
   protein/DNA complex; complexed with fad

Details for d2wq6a1

PDB Entry: 2wq6, 2.3 Å

PDB Description: structure of the 6-4 photolyase of d. melanogaster in complex with the non-natural n4-methyl t(dewar)c lesion

PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d2wq6a1:

Sequence; same for both SEQRES and ATOM records:

>d2wq6a1 c.28.1.0 (A:2-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dsqrstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrw
rflqqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaa
vqklakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpekl
knmptppkdeveqkdsaaydcptmkqlvkrpeel

Timeline for d2wq6a1:

• d2wq6a1 first appeared in SCOPe 2.04
  
• d2wq6a1 appears in SCOPe 2.07