| Class b: All beta proteins [48724] (178 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (16 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [255619] (1 PDB entry) |
| Domain d2vpqa3: 2vpq A:330-448 [243924] Other proteins in same PDB: d2vpqa1, d2vpqa2, d2vpqb1, d2vpqb2 automated match to d1ulza1 complexed with anp, cl, mg |
PDB Entry: 2vpq (more details), 2.1 Å
SCOPe Domain Sequences for d2vpqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vpqa3 b.84.2.0 (A:330-448) automated matches {Staphylococcus aureus [TaxId: 1280]}
ltghaiefrinaenpyknfmpspgkieqylapggygvriesacytnytippyydsmvakl
iiheptrdeaimagiralsefvvlgidttipfhikllnndifrsgkfntnfleqnsimn
Timeline for d2vpqa3: