SCOPe 2.06: Domain d2vpqa3: 2vpq A:330-448

Lineage for d2vpqa3 (2vpq A:330-448)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (13 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [255619] (1 PDB entry)

8. Domain d2vpqa3: 2vpq A:330-448 [243924]
   Other proteins in same PDB: d2vpqa1, d2vpqa2, d2vpqb1, d2vpqb2
   automated match to d1ulza1
   complexed with anp, cl, mg

Details for d2vpqa3

PDB Entry: 2vpq, 2.1 Å

PDB Description: crystal structure of biotin carboxylase from s. aureus complexed with amppnp

PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2vpqa3:

Sequence; same for both SEQRES and ATOM records:

>d2vpqa3 b.84.2.0 (A:330-448) automated matches {Staphylococcus aureus [TaxId: 1280]}
ltghaiefrinaenpyknfmpspgkieqylapggygvriesacytnytippyydsmvakl
iiheptrdeaimagiralsefvvlgidttipfhikllnndifrsgkfntnfleqnsimn

Timeline for d2vpqa3:

• d2vpqa3 first appeared in SCOPe 2.04
  
• d2vpqa3 appears in SCOPe 2.05
  
• d2vpqa3 appears in SCOPe 2.07
  
• d2vpqa3 appears in the current release, SCOPe 2.08