Lineage for d2vpqa1 (2vpq A:2-114)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470135Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2470136Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2470597Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2470598Protein automated matches [226903] (39 species)
    not a true protein
  7. 2470728Species Staphylococcus aureus [TaxId:1280] [225145] (3 PDB entries)
  8. 2470731Domain d2vpqa1: 2vpq A:2-114 [243922]
    Other proteins in same PDB: d2vpqa2, d2vpqa3, d2vpqb2, d2vpqb3
    automated match to d1ulza2
    complexed with anp, cl, mg

Details for d2vpqa1

PDB Entry: 2vpq (more details), 2.1 Å

PDB Description: crystal structure of biotin carboxylase from s. aureus complexed with amppnp
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2vpqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpqa1 c.30.1.0 (A:2-114) automated matches {Staphylococcus aureus [TaxId: 1280]}
kkvlianrgeiavriiracrdlgiqtvaiysegdkdalhtqiadeaycvgptlskdsyln
ipnilsiatstgcdgvhpgygflaenadfaelceacqlkfigpsyqsiqkmgi

SCOPe Domain Coordinates for d2vpqa1:

Click to download the PDB-style file with coordinates for d2vpqa1.
(The format of our PDB-style files is described here.)

Timeline for d2vpqa1: