SCOPe 2.04: Domain d2vpqa1: 2vpq A:2-114

Lineage for d2vpqa1 (2vpq A:2-114)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (25 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225145] (3 PDB entries)

8. Domain d2vpqa1: 2vpq A:2-114 [243922]
   Other proteins in same PDB: d2vpqa2, d2vpqa3, d2vpqb2, d2vpqb3
   automated match to d1ulza2
   complexed with anp, cl, mg

Details for d2vpqa1

PDB Entry: 2vpq, 2.1 Å

PDB Description: crystal structure of biotin carboxylase from s. aureus complexed with amppnp

PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d2vpqa1:

Sequence; same for both SEQRES and ATOM records:

>d2vpqa1 c.30.1.0 (A:2-114) automated matches {Staphylococcus aureus [TaxId: 1280]}
kkvlianrgeiavriiracrdlgiqtvaiysegdkdalhtqiadeaycvgptlskdsyln
ipnilsiatstgcdgvhpgygflaenadfaelceacqlkfigpsyqsiqkmgi

Timeline for d2vpqa1:

• d2vpqa1 is new in SCOPe 2.04-stable
  
• d2vpqa1 appears in SCOPe 2.05
  
• d2vpqa1 appears in the current release, SCOPe 2.08