Lineage for d2qqba2 (2qqb A:65-139)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718817Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2718818Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2718819Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2718820Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 2718821Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
    Uniprot P33120
  8. 2718830Domain d2qqba2: 2qqb A:65-139 [243628]
    Other proteins in same PDB: d2qqba1, d2qqba3
    automated match to d2dtra2
    protein/DNA complex; complexed with ni, po4

Details for d2qqba2

PDB Entry: 2qqb (more details), 1.92 Å

PDB Description: crystal structure of dtxr(m10a c102d) complexed with nickel(ii)
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d2qqba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qqba2 a.76.1.1 (A:65-139) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelg

SCOPe Domain Coordinates for d2qqba2:

Click to download the PDB-style file with coordinates for d2qqba2.
(The format of our PDB-style files is described here.)

Timeline for d2qqba2: