![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries) Uniprot P33120 |
![]() | Domain d2qqba1: 2qqb A:3-64 [243627] Other proteins in same PDB: d2qqba2, d2qqba3 automated match to d2dtra1 protein/DNA complex; complexed with ni, po4 |
PDB Entry: 2qqb (more details), 1.92 Å
SCOPe Domain Sequences for d2qqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qqba1 a.4.5.24 (A:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} dlvdtteaylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl qm
Timeline for d2qqba1: