PDB entry 2qqb

View 2qqb on RCSB PDB site
Description: Crystal Structure of DtxR(M10A C102D) Complexed with Nickel(II)
Class: Transcription regulator
Keywords: REPRESSOR, REGULATOR, DTXR, HELIX-TURN-HELIX, METAL ION, ACTIVATION, DNA-BINDING, FERROUS IRON, Cytoplasm, Transcription, Transcription regulation, Transcription regulator
Deposited on 2007-07-26, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120 (Start-225)
      • engineered (9)
      • engineered (101)
      • variant (213)
    Domains in SCOPe 2.07: d2qqba1, d2qqba2, d2qqba3
  • Heterogens: NI, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qqbA (A:)
    mkdlvdtteaylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qqbA (A:)
    dlvdtteaylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
    qmtptgrtlatavmrkhrlaerlltdiigldinkvhdeadrwehvmsdeverrlvkvlkd
    vsrspfgnpipgldelggtrvidaatsmprkvrivqineifqvetdqftqlldadirvgs
    eveivdrghitlshngkdvellddlahtirieel