SCOPe 2.08: Domain d2p6tg1: 2p6t G:1-65

Lineage for d2p6tg1 (2p6t G:1-65)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [231118] (3 PDB entries)

8. Domain d2p6tg1: 2p6t G:1-65 [243444]
   Other proteins in same PDB: d2p6ta2, d2p6tb2, d2p6tc2, d2p6td2, d2p6te2, d2p6tf2, d2p6tg2, d2p6th2
   automated match to d2p5vg1
   complexed with ca, gol, leu

Details for d2p6tg1

PDB Entry: 2p6t, 2.9 Å

PDB Description: crystal structure of transcriptional regulator nmb0573 and l-leucine complex from neisseria meningitidis

PDB Compounds: (G:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p6tg1:

Sequence; same for both SEQRES and ATOM records:

>d2p6tg1 a.4.5.0 (G:1-65) automated matches {Neisseria meningitidis [TaxId: 122586]}
mpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaalls
pesvn

Timeline for d2p6tg1:

• d2p6tg1 first appeared in SCOPe 2.04
  
• d2p6tg1 appears in SCOPe 2.07