SCOPe 2.08: Domain d2p6tb2: 2p6t B:66-159

Lineage for d2p6tb2 (2p6t B:66-159)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries)

8. Domain d2p6tb2: 2p6t B:66-159 [243435]
   Other proteins in same PDB: d2p6ta1, d2p6tb1, d2p6tc1, d2p6td1, d2p6te1, d2p6tf1, d2p6tg1, d2p6th1
   automated match to d2p5vb2
   complexed with ca, gol, leu

Details for d2p6tb2

PDB Entry: 2p6t, 2.9 Å

PDB Description: crystal structure of transcriptional regulator nmb0573 and l-leucine complex from neisseria meningitidis

PDB Compounds: (B:) Transcriptional regulator, LRP/AsnC family

SCOPe Domain Sequences for d2p6tb2:

Sequence; same for both SEQRES and ATOM records:

>d2p6tb2 d.58.4.0 (B:66-159) automated matches {Neisseria meningitidis [TaxId: 122586]}
lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl
dtllshhgvqdaqssfvlkeikhttslplnhllk

Timeline for d2p6tb2:

• d2p6tb2 first appeared in SCOPe 2.04
  
• d2p6tb2 appears in SCOPe 2.07