![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
![]() | Protein automated matches [190081] (33 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:122586] [231120] (3 PDB entries) |
![]() | Domain d2p6tb2: 2p6t B:66-159 [243435] Other proteins in same PDB: d2p6ta1, d2p6tb1, d2p6tc1, d2p6td1, d2p6te1, d2p6tf1, d2p6tg1, d2p6th1 automated match to d2p5vb2 complexed with ca, gol, leu |
PDB Entry: 2p6t (more details), 2.9 Å
SCOPe Domain Sequences for d2p6tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6tb2 d.58.4.0 (B:66-159) automated matches {Neisseria meningitidis [TaxId: 122586]} lglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfvl dtllshhgvqdaqssfvlkeikhttslplnhllk
Timeline for d2p6tb2: